| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147256.1 | internal | 111 | 2-334(+) |
Amino Acid sequence : | |||
| FVRAKSFGPEENSIVCILTDCRPRLDPPVEDGYFGNCVRLTNVNILVGDQTSEDRLSRACEEIGASIRRVSEDPLRDVEDWFDDLQNLPLERVTNVTASPRFKIYETDFGF | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,656.987 | ||
| Theoretical pI: | 4.472 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 49.945 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.412 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.234 | ||
| sheet | 0.207 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147256.1 | internal | 111 | 2-334(+) |
Amino Acid sequence : | |||
| FVRAKSFGPEENSIVCILTDCRPRLDPPVEDGYFGNCVRLTNVNILVGDQTSEDRLSRACEEIGASIRRVSEDPLRDVEDWFDDLQNLPLERVTNVTASPRFKIYETDFGF | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,656.987 | ||
| Theoretical pI: | 4.472 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 49.945 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.412 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.234 | ||
| sheet | 0.207 | ||