Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147257.1 | internal | 104 | 1-312(+) |
Amino Acid sequence : | |||
TLLGYSAQGACKFGFYEFFKKYYSDIAGPEYAAKYKTLIYLAGSASAEVIADVALCPMEAVKVRVQTQPGFARGLSDGLPKFVKAEGALGLYKGLVPLWGRQIP | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 11,247.969 | ||
Theoretical pI: | 9.097 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17545 | ||
Instability index: | 22.772 | ||
aromaticity | 0.144 | ||
GRAVY | 0.151 | ||
Secondary Structure Fraction | |||
Helix | 0.356 | ||
turn | 0.221 | ||
sheet | 0.298 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147257.1 | internal | 104 | 1-312(+) |
Amino Acid sequence : | |||
TLLGYSAQGACKFGFYEFFKKYYSDIAGPEYAAKYKTLIYLAGSASAEVIADVALCPMEAVKVRVQTQPGFARGLSDGLPKFVKAEGALGLYKGLVPLWGRQIP | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 11,247.969 | ||
Theoretical pI: | 9.097 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17545 | ||
Instability index: | 22.772 | ||
aromaticity | 0.144 | ||
GRAVY | 0.151 | ||
Secondary Structure Fraction | |||
Helix | 0.356 | ||
turn | 0.221 | ||
sheet | 0.298 |