Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147281.1 | complete | 113 | 110-451(+) |
Amino Acid sequence : | |||
MSDLDVQIPTAFDPFAEANAEDSGAGTKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSGFLVQAGIVKKEHIKIHGF* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,608.198 | ||
Theoretical pI: | 8.565 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 25.894 | ||
aromaticity | 0.071 | ||
GRAVY | -0.492 | ||
Secondary Structure Fraction | |||
Helix | 0.292 | ||
turn | 0.204 | ||
sheet | 0.195 |