Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147282.1 | internal | 171 | 3-515(+) |
Amino Acid sequence : | |||
TREDLILINYIANHGEGVWNTLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHSRWGNRWSKIARQLPGRTDNEIKNYWRTRIQKKTKSEPLDYQNQQMMMVDDASTSH SNNGIDEGNAQQSYQMDMNNISSTSTDAFAVPMFSTESSENFWTVEDFWTM | |||
Physicochemical properties | |||
Number of amino acids: | 171 | ||
Molecular weight: | 19,955.090 | ||
Theoretical pI: | 6.774 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45950 45950 | ||
Instability index: | 48.664 | ||
aromaticity | 0.094 | ||
GRAVY | -0.862 | ||
Secondary Structure Fraction | |||
Helix | 0.251 | ||
turn | 0.257 | ||
sheet | 0.228 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147282.1 | internal | 171 | 3-515(+) |
Amino Acid sequence : | |||
TREDLILINYIANHGEGVWNTLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHSRWGNRWSKIARQLPGRTDNEIKNYWRTRIQKKTKSEPLDYQNQQMMMVDDASTSH SNNGIDEGNAQQSYQMDMNNISSTSTDAFAVPMFSTESSENFWTVEDFWTM | |||
Physicochemical properties | |||
Number of amino acids: | 171 | ||
Molecular weight: | 19,955.090 | ||
Theoretical pI: | 6.774 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45950 45950 | ||
Instability index: | 48.664 | ||
aromaticity | 0.094 | ||
GRAVY | -0.862 | ||
Secondary Structure Fraction | |||
Helix | 0.251 | ||
turn | 0.257 | ||
sheet | 0.228 |