| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147305.1 | internal | 120 | 2-361(+) |
Amino Acid sequence : | |||
| AKSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHSRWGNRWSKIARQLPGRTDNEIKNYWRTRIQKKTKSEPLDYQNQQMMMVDDASTSHSNNGIDEGNAQQSYQMDMNNIS | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 14,097.729 | ||
| Theoretical pI: | 9.860 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
| Instability index: | 56.837 | ||
| aromaticity | 0.067 | ||
| GRAVY | -1.169 | ||
Secondary Structure Fraction | |||
| Helix | 0.217 | ||
| turn | 0.267 | ||
| sheet | 0.217 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147305.1 | internal | 120 | 2-361(+) |
Amino Acid sequence : | |||
| AKSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHSRWGNRWSKIARQLPGRTDNEIKNYWRTRIQKKTKSEPLDYQNQQMMMVDDASTSHSNNGIDEGNAQQSYQMDMNNIS | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 14,097.729 | ||
| Theoretical pI: | 9.860 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
| Instability index: | 56.837 | ||
| aromaticity | 0.067 | ||
| GRAVY | -1.169 | ||
Secondary Structure Fraction | |||
| Helix | 0.217 | ||
| turn | 0.267 | ||
| sheet | 0.217 | ||