| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147323.1 | 5prime_partial | 107 | 2-325(+) |
Amino Acid sequence : | |||
| HEACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTMGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQNLVVDGGYSVGNPSINAF* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 11,262.535 | ||
| Theoretical pI: | 4.958 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 24.893 | ||
| aromaticity | 0.075 | ||
| GRAVY | 0.176 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.271 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147323.1 | 5prime_partial | 107 | 2-325(+) |
Amino Acid sequence : | |||
| HEACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTMGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQNLVVDGGYSVGNPSINAF* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 11,262.535 | ||
| Theoretical pI: | 4.958 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 24.893 | ||
| aromaticity | 0.075 | ||
| GRAVY | 0.176 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.271 | ||
| sheet | 0.280 | ||