| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147334.1 | 5prime_partial | 129 | 3-392(+) |
Amino Acid sequence : | |||
| AGIRHQISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQNLVVDGGYS VGNPSINAF* | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 13,415.932 | ||
| Theoretical pI: | 5.718 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 27.144 | ||
| aromaticity | 0.070 | ||
| GRAVY | 0.205 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.295 | ||
| sheet | 0.248 | ||