Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147338.1 | internal | 200 | 2-601(+) |
Amino Acid sequence : | |||
TAGTIDIRKYGAAGDGKTDCTKAVQQAWNEGCAAEGNQEIWAPVGDYLVGPLLFKGPCKGEITLQLAGNLLAQPNHEIYDKTWINIQYVSGLTISGAGKLDGQGAQAWPHNSCPKKWECK TLPMSLVLSFVNNASISGISSINSKFFHLHIFNVNNLTISNIKIEAPDESPNTDGIHVAGSTNIKILDSTIGTGDDCISV | |||
Physicochemical properties | |||
Number of amino acids: | 200 | ||
Molecular weight: | 21,313.814 | ||
Theoretical pI: | 5.445 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33835 | ||
Instability index: | 35.007 | ||
aromaticity | 0.070 | ||
GRAVY | -0.137 | ||
Secondary Structure Fraction | |||
Helix | 0.290 | ||
turn | 0.300 | ||
sheet | 0.200 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147338.1 | internal | 200 | 2-601(+) |
Amino Acid sequence : | |||
TAGTIDIRKYGAAGDGKTDCTKAVQQAWNEGCAAEGNQEIWAPVGDYLVGPLLFKGPCKGEITLQLAGNLLAQPNHEIYDKTWINIQYVSGLTISGAGKLDGQGAQAWPHNSCPKKWECK TLPMSLVLSFVNNASISGISSINSKFFHLHIFNVNNLTISNIKIEAPDESPNTDGIHVAGSTNIKILDSTIGTGDDCISV | |||
Physicochemical properties | |||
Number of amino acids: | 200 | ||
Molecular weight: | 21,313.814 | ||
Theoretical pI: | 5.445 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33835 | ||
Instability index: | 35.007 | ||
aromaticity | 0.070 | ||
GRAVY | -0.137 | ||
Secondary Structure Fraction | |||
Helix | 0.290 | ||
turn | 0.300 | ||
sheet | 0.200 |