Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147339.1 | internal | 197 | 2-592(+) |
Amino Acid sequence : | |||
SLDWTKSQSHTLSGRKISDHYEEELISGASSSYTGQKLGGGSKSSSNARASSVAAAYNRFINTSPEKAYPSDEDQLSNASSGTEPYDGDLRGVQENIHAELDPNDVPMIEDDASSVEIMM DHMGSPYGASINVEDEEPKMGAGKAFVSIVEPDPDNSELGEAIEAFSEPDPDDSMLGNADLSRSEEPDPDDLASAQE | |||
Physicochemical properties | |||
Number of amino acids: | 197 | ||
Molecular weight: | 20,994.107 | ||
Theoretical pI: | 4.064 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
Instability index: | 56.830 | ||
aromaticity | 0.051 | ||
GRAVY | -0.805 | ||
Secondary Structure Fraction | |||
Helix | 0.188 | ||
turn | 0.345 | ||
sheet | 0.284 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147339.1 | internal | 197 | 2-592(+) |
Amino Acid sequence : | |||
SLDWTKSQSHTLSGRKISDHYEEELISGASSSYTGQKLGGGSKSSSNARASSVAAAYNRFINTSPEKAYPSDEDQLSNASSGTEPYDGDLRGVQENIHAELDPNDVPMIEDDASSVEIMM DHMGSPYGASINVEDEEPKMGAGKAFVSIVEPDPDNSELGEAIEAFSEPDPDDSMLGNADLSRSEEPDPDDLASAQE | |||
Physicochemical properties | |||
Number of amino acids: | 197 | ||
Molecular weight: | 20,994.107 | ||
Theoretical pI: | 4.064 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
Instability index: | 56.830 | ||
aromaticity | 0.051 | ||
GRAVY | -0.805 | ||
Secondary Structure Fraction | |||
Helix | 0.188 | ||
turn | 0.345 | ||
sheet | 0.284 |