Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147359.1 | complete | 128 | 115-501(+) |
Amino Acid sequence : | |||
MLVLRVPGRQTSFALTIWSVPLKLPAAKASRVARWTAASEFSWHSLVPTRTMLFSTHGTKCLSSVSTLSMDCTPTSRVLSQTNSLTSSNIAHLVWTCLVIFTWSFPHTFPLLLLEDVKNL IMTWASKH* | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 13,731.289 | ||
Theoretical pI: | 7.760 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
Instability index: | 28.456 | ||
aromaticity | 0.120 | ||
GRAVY | -0.115 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.264 | ||
sheet | 0.200 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147359.1 | 5prime_partial | 125 | 3-380(+) |
Amino Acid sequence : | |||
AARSLPAFVSNSTYTVTSFTLVLEFQKGTLQNLYWKRDACASCSGKTNFVCLNNLECAIKTSSCKGQQGGSVDCSVGIQLAFSGTDKNDAVLNSWYEVSKLRQYSLYGLYSDLKSSLTDQ FTDIF* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 13,731.289 | ||
Theoretical pI: | 7.760 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
Instability index: | 28.456 | ||
aromaticity | 0.120 | ||
GRAVY | -0.115 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.264 | ||
sheet | 0.200 |