| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147385.1 | internal | 107 | 3-323(+) |
Amino Acid sequence : | |||
| ESKNALENYSYNMRNTIRDDKIALKLPAEDKKKIEDVIEEAILWLEANQLAEADEFDDKMKELEGICNPIIAKMYQGAGADMGAGMDEDGPAPTGGSSAGPKIEEVD | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 11,580.612 | ||
| Theoretical pI: | 11.540 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 39.768 | ||
| aromaticity | 0.009 | ||
| GRAVY | 0.552 | ||
Secondary Structure Fraction | |||
| Helix | 0.430 | ||
| turn | 0.234 | ||
| sheet | 0.290 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147385.1 | internal | 107 | 323-3(-) |
Amino Acid sequence : | |||
| VDLLNFRPSTATAGRSGTILVHAGAHISTGTLIHLRNNGVADSLKLLHLVIKLVRLRQLVRLEPQDGLLNHVLNLLLVLGRQLQCNLVVSNGVPHVVRVVLQSILGL | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 11,580.612 | ||
| Theoretical pI: | 11.540 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 39.768 | ||
| aromaticity | 0.009 | ||
| GRAVY | 0.552 | ||
Secondary Structure Fraction | |||
| Helix | 0.430 | ||
| turn | 0.234 | ||
| sheet | 0.290 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147385.1 | internal | 107 | 3-323(+) |
Amino Acid sequence : | |||
| ESKNALENYSYNMRNTIRDDKIALKLPAEDKKKIEDVIEEAILWLEANQLAEADEFDDKMKELEGICNPIIAKMYQGAGADMGAGMDEDGPAPTGGSSAGPKIEEVD | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 11,580.612 | ||
| Theoretical pI: | 11.540 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 39.768 | ||
| aromaticity | 0.009 | ||
| GRAVY | 0.552 | ||
Secondary Structure Fraction | |||
| Helix | 0.430 | ||
| turn | 0.234 | ||
| sheet | 0.290 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147385.1 | internal | 107 | 323-3(-) |
Amino Acid sequence : | |||
| VDLLNFRPSTATAGRSGTILVHAGAHISTGTLIHLRNNGVADSLKLLHLVIKLVRLRQLVRLEPQDGLLNHVLNLLLVLGRQLQCNLVVSNGVPHVVRVVLQSILGL | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 11,580.612 | ||
| Theoretical pI: | 11.540 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 39.768 | ||
| aromaticity | 0.009 | ||
| GRAVY | 0.552 | ||
Secondary Structure Fraction | |||
| Helix | 0.430 | ||
| turn | 0.234 | ||
| sheet | 0.290 | ||