| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147400.1 | internal | 178 | 1-534(+) |
Amino Acid sequence : | |||
| VPFGKNYVPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGSYLFGHFSMQIKLVPGDSAGTVTAFYLSSQNSEHDEIDFEFLGNTTGQPYILQTNVFTGWQGNREQRIYLWFDPTKDYH SYSVLWNMYQIVFLVDDVPIRVFKNCKELGLRFPFNQPMKIYSSLWNADDWATRGGLV | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 15,145.362 | ||
| Theoretical pI: | 6.651 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 47.464 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.075 | ||
Secondary Structure Fraction | |||
| Helix | 0.366 | ||
| turn | 0.224 | ||
| sheet | 0.261 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147400.1 | 5prime_partial | 134 | 534-130(-) |
Amino Acid sequence : | |||
| HQAAPRGPVIRVPKTGVDLHGLVERKTEAQFLAILEHSDGNIIYQEDNLVHVPEDRVGMIVLGWVEPEVNSLLSVSLPSGEHVRLQYIGLTCCVAKKLKVYLIMLRVLRREIESSDSSSR IPWNQFYLHAEVPK* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 15,145.362 | ||
| Theoretical pI: | 6.651 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 47.464 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.075 | ||
Secondary Structure Fraction | |||
| Helix | 0.366 | ||
| turn | 0.224 | ||
| sheet | 0.261 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147400.1 | internal | 178 | 1-534(+) |
Amino Acid sequence : | |||
| VPFGKNYVPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGSYLFGHFSMQIKLVPGDSAGTVTAFYLSSQNSEHDEIDFEFLGNTTGQPYILQTNVFTGWQGNREQRIYLWFDPTKDYH SYSVLWNMYQIVFLVDDVPIRVFKNCKELGLRFPFNQPMKIYSSLWNADDWATRGGLV | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 15,145.362 | ||
| Theoretical pI: | 6.651 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 47.464 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.075 | ||
Secondary Structure Fraction | |||
| Helix | 0.366 | ||
| turn | 0.224 | ||
| sheet | 0.261 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147400.1 | 5prime_partial | 134 | 534-130(-) |
Amino Acid sequence : | |||
| HQAAPRGPVIRVPKTGVDLHGLVERKTEAQFLAILEHSDGNIIYQEDNLVHVPEDRVGMIVLGWVEPEVNSLLSVSLPSGEHVRLQYIGLTCCVAKKLKVYLIMLRVLRREIESSDSSSR IPWNQFYLHAEVPK* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 15,145.362 | ||
| Theoretical pI: | 6.651 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 47.464 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.075 | ||
Secondary Structure Fraction | |||
| Helix | 0.366 | ||
| turn | 0.224 | ||
| sheet | 0.261 | ||