Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147401.1 | complete | 105 | 55-372(+) |
Amino Acid sequence : | |||
MSSQPEGVMGSIMGAVQNAKDAIVGKPGETKEAEKVGENKGNLSSQAQEMKQKAGETIQEYGKKLTESKETAGHPVEKDSDKGGGIMGSMGNMAGSIKEKFTGPT* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 10,903.135 | ||
Theoretical pI: | 5.860 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 27.062 | ||
aromaticity | 0.019 | ||
GRAVY | -0.853 | ||
Secondary Structure Fraction | |||
Helix | 0.133 | ||
turn | 0.324 | ||
sheet | 0.276 |