| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147401.1 | complete | 105 | 55-372(+) |
Amino Acid sequence : | |||
| MSSQPEGVMGSIMGAVQNAKDAIVGKPGETKEAEKVGENKGNLSSQAQEMKQKAGETIQEYGKKLTESKETAGHPVEKDSDKGGGIMGSMGNMAGSIKEKFTGPT* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 10,903.135 | ||
| Theoretical pI: | 5.860 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 27.062 | ||
| aromaticity | 0.019 | ||
| GRAVY | -0.853 | ||
Secondary Structure Fraction | |||
| Helix | 0.133 | ||
| turn | 0.324 | ||
| sheet | 0.276 | ||