Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147408.1 | internal | 153 | 2-460(+) |
Amino Acid sequence : | |||
VTEIGSSVSHFKIGDNIGVGTYVNSCRDCENCNEYIENHCSKGGLVLTFNGKDSDGTVTKGGYSSYIVVHERYCFKIPDGYPLAMAAPLLCAGITVYTPMMHHNMKQPGKSLGVIGLGGL GHMAVKFGKAFGLKVTVFSTSESKREEALKLLG | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 16,370.681 | ||
Theoretical pI: | 8.225 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10805 | ||
Instability index: | 27.325 | ||
aromaticity | 0.085 | ||
GRAVY | -0.028 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.294 | ||
sheet | 0.209 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147408.1 | internal | 153 | 2-460(+) |
Amino Acid sequence : | |||
VTEIGSSVSHFKIGDNIGVGTYVNSCRDCENCNEYIENHCSKGGLVLTFNGKDSDGTVTKGGYSSYIVVHERYCFKIPDGYPLAMAAPLLCAGITVYTPMMHHNMKQPGKSLGVIGLGGL GHMAVKFGKAFGLKVTVFSTSESKREEALKLLG | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 16,370.681 | ||
Theoretical pI: | 8.225 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10805 | ||
Instability index: | 27.325 | ||
aromaticity | 0.085 | ||
GRAVY | -0.028 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.294 | ||
sheet | 0.209 |