| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147414.1 | 5prime_partial | 200 | 3-605(+) |
Amino Acid sequence : | |||
| RRWRREMAFMICFPMMIMMLFLFPLISFAQPISVHTYPAALKSSSIIPQPQDNQQVVGPCLYTVQIHTSCLSPPKTNDYIAIKFGDSFYHRVYKQIKAPRRDFQFRNCSSDTFNIQGPCG TADSICYLYLGRYGNDGWRPDTVTVRKLNSRNSRSSMFKFDSVLPNNIWCGFDRCRGEISSPPSNNDATYDYRDGYHCTA* | |||
Physicochemical properties | |||
| Number of amino acids: | 200 | ||
| Molecular weight: | 16,497.034 | ||
| Theoretical pI: | 9.412 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 31.844 | ||
| aromaticity | 0.078 | ||
| GRAVY | 0.473 | ||
Secondary Structure Fraction | |||
| Helix | 0.399 | ||
| turn | 0.216 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147414.1 | complete | 153 | 593-132(-) |
Amino Acid sequence : | |||
| MITVTIIVSRIVVGGRGGDLSSAAVETAPYVIRKNAVKFEHAAATVATVELPYRYSIGSPAVVPVSAQIQVANTISGTARTLNVECVGGAVAELEIPSRRLYLLIHPVIKTVAKLDGYVV VGFWWRQAASVYLHRVEARPYDLLIILGLWNNG* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 16,497.034 | ||
| Theoretical pI: | 9.412 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 31.844 | ||
| aromaticity | 0.078 | ||
| GRAVY | 0.473 | ||
Secondary Structure Fraction | |||
| Helix | 0.399 | ||
| turn | 0.216 | ||
| sheet | 0.255 | ||