Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147423.1 | internal | 100 | 1-300(+) |
Amino Acid sequence : | |||
GLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELSTQDKELAGISPGLVRMSVG | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,315.547 | ||
Theoretical pI: | 11.528 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 60.940 | ||
aromaticity | 0.020 | ||
GRAVY | -1.358 | ||
Secondary Structure Fraction | |||
Helix | 0.172 | ||
turn | 0.293 | ||
sheet | 0.131 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147423.1 | internal | 99 | 3-299(+) |
Amino Acid sequence : | |||
PQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRVEHSGQGACRHLPRTSQDVCR | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,315.547 | ||
Theoretical pI: | 11.528 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 60.940 | ||
aromaticity | 0.020 | ||
GRAVY | -1.358 | ||
Secondary Structure Fraction | |||
Helix | 0.172 | ||
turn | 0.293 | ||
sheet | 0.131 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147423.1 | internal | 100 | 1-300(+) |
Amino Acid sequence : | |||
GLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELSTQDKELAGISPGLVRMSVG | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,315.547 | ||
Theoretical pI: | 11.528 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 60.940 | ||
aromaticity | 0.020 | ||
GRAVY | -1.358 | ||
Secondary Structure Fraction | |||
Helix | 0.172 | ||
turn | 0.293 | ||
sheet | 0.131 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147423.1 | internal | 99 | 3-299(+) |
Amino Acid sequence : | |||
PQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRVEHSGQGACRHLPRTSQDVCR | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,315.547 | ||
Theoretical pI: | 11.528 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 60.940 | ||
aromaticity | 0.020 | ||
GRAVY | -1.358 | ||
Secondary Structure Fraction | |||
Helix | 0.172 | ||
turn | 0.293 | ||
sheet | 0.131 |