| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147423.1 | internal | 100 | 1-300(+) |
Amino Acid sequence : | |||
| GLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELSTQDKELAGISPGLVRMSVG | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,315.547 | ||
| Theoretical pI: | 11.528 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 60.940 | ||
| aromaticity | 0.020 | ||
| GRAVY | -1.358 | ||
Secondary Structure Fraction | |||
| Helix | 0.172 | ||
| turn | 0.293 | ||
| sheet | 0.131 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147423.1 | internal | 99 | 3-299(+) |
Amino Acid sequence : | |||
| PQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRVEHSGQGACRHLPRTSQDVCR | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,315.547 | ||
| Theoretical pI: | 11.528 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 60.940 | ||
| aromaticity | 0.020 | ||
| GRAVY | -1.358 | ||
Secondary Structure Fraction | |||
| Helix | 0.172 | ||
| turn | 0.293 | ||
| sheet | 0.131 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147423.1 | internal | 100 | 1-300(+) |
Amino Acid sequence : | |||
| GLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELSTQDKELAGISPGLVRMSVG | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,315.547 | ||
| Theoretical pI: | 11.528 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 60.940 | ||
| aromaticity | 0.020 | ||
| GRAVY | -1.358 | ||
Secondary Structure Fraction | |||
| Helix | 0.172 | ||
| turn | 0.293 | ||
| sheet | 0.131 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147423.1 | internal | 99 | 3-299(+) |
Amino Acid sequence : | |||
| PQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRVEHSGQGACRHLPRTSQDVCR | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,315.547 | ||
| Theoretical pI: | 11.528 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 60.940 | ||
| aromaticity | 0.020 | ||
| GRAVY | -1.358 | ||
Secondary Structure Fraction | |||
| Helix | 0.172 | ||
| turn | 0.293 | ||
| sheet | 0.131 | ||