| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147437.1 | internal | 145 | 1-435(+) |
Amino Acid sequence : | |||
| KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ LEDGRTLADYNIQKESTLHLVLRLR | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 16,201.997 | ||
| Theoretical pI: | 10.108 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 60.095 | ||
| aromaticity | 0.021 | ||
| GRAVY | -0.042 | ||
Secondary Structure Fraction | |||
| Helix | 0.372 | ||
| turn | 0.283 | ||
| sheet | 0.317 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147437.1 | internal | 145 | 435-1(-) |
Amino Acid sequence : | |||
| TETENKMEGGLLLDVVIRKGPPILQLLPSKNQPLLVRRNPLLILNLRLHIINRIRALHLQSNSLPGQGLHEYLHATTKPQNEMEGRLLLDVVVRKGPPILQLFPGKDEPLLVRRNPFLVL NLCLHIVNRVGALNLEGNGLPSQGL | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 16,201.997 | ||
| Theoretical pI: | 10.108 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 60.095 | ||
| aromaticity | 0.021 | ||
| GRAVY | -0.042 | ||
Secondary Structure Fraction | |||
| Helix | 0.372 | ||
| turn | 0.283 | ||
| sheet | 0.317 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147437.1 | internal | 145 | 1-435(+) |
Amino Acid sequence : | |||
| KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ LEDGRTLADYNIQKESTLHLVLRLR | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 16,201.997 | ||
| Theoretical pI: | 10.108 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 60.095 | ||
| aromaticity | 0.021 | ||
| GRAVY | -0.042 | ||
Secondary Structure Fraction | |||
| Helix | 0.372 | ||
| turn | 0.283 | ||
| sheet | 0.317 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147437.1 | internal | 145 | 435-1(-) |
Amino Acid sequence : | |||
| TETENKMEGGLLLDVVIRKGPPILQLLPSKNQPLLVRRNPLLILNLRLHIINRIRALHLQSNSLPGQGLHEYLHATTKPQNEMEGRLLLDVVVRKGPPILQLFPGKDEPLLVRRNPFLVL NLCLHIVNRVGALNLEGNGLPSQGL | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 16,201.997 | ||
| Theoretical pI: | 10.108 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 60.095 | ||
| aromaticity | 0.021 | ||
| GRAVY | -0.042 | ||
Secondary Structure Fraction | |||
| Helix | 0.372 | ||
| turn | 0.283 | ||
| sheet | 0.317 | ||