| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147446.1 | internal | 128 | 384-1(-) |
Amino Acid sequence : | |||
| QISHITTTETENKMEGGLLLDVVIRKGPPILQLLPSKNQPLLVRRNPLLILNLRLHIINRIRALHLQSNSLPGQGLHEYLHATTKPQNEMEGRLLLDVVVRKGPPILQLFPGKDEPLLVR RNPFLVLN | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,084.934 | ||
| Theoretical pI: | 6.155 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 34.597 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.538 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.176 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147446.1 | 5prime_partial | 125 | 1-378(+) |
Amino Acid sequence : | |||
| IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL RGGDM* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 14,084.934 | ||
| Theoretical pI: | 6.155 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 34.597 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.538 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.176 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147446.1 | internal | 128 | 384-1(-) |
Amino Acid sequence : | |||
| QISHITTTETENKMEGGLLLDVVIRKGPPILQLLPSKNQPLLVRRNPLLILNLRLHIINRIRALHLQSNSLPGQGLHEYLHATTKPQNEMEGRLLLDVVVRKGPPILQLFPGKDEPLLVR RNPFLVLN | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,084.934 | ||
| Theoretical pI: | 6.155 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 34.597 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.538 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.176 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147446.1 | 5prime_partial | 125 | 1-378(+) |
Amino Acid sequence : | |||
| IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL RGGDM* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 14,084.934 | ||
| Theoretical pI: | 6.155 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 34.597 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.538 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.176 | ||
| sheet | 0.248 | ||