| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147468.1 | 5prime_partial | 100 | 326-24(-) |
Amino Acid sequence : | |||
| VKGDLSPPTEILTRISANRERPSSLRLPNVLFIIVVLGCHNNPLSHKVSGIESHTKLTNHAHISPSSQCLHELFGSRPCNGTEIIDQDRSWSYQHHCQSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,144.471 | ||
| Theoretical pI: | 7.921 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
| Instability index: | 67.559 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.390 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.320 | ||
| sheet | 0.170 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147468.1 | 5prime_partial | 100 | 326-24(-) |
Amino Acid sequence : | |||
| VKGDLSPPTEILTRISANRERPSSLRLPNVLFIIVVLGCHNNPLSHKVSGIESHTKLTNHAHISPSSQCLHELFGSRPCNGTEIIDQDRSWSYQHHCQSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,144.471 | ||
| Theoretical pI: | 7.921 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
| Instability index: | 67.559 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.390 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.320 | ||
| sheet | 0.170 | ||