| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147486.1 | internal | 202 | 2-607(+) |
Amino Acid sequence : | |||
| HEKMNYLAMKTDGVGSGLLESDLKNIGIAATQFANDTYLMLGGLGFGTSFLAFFACAAAIYLLILDRTNWKTNMLTSLLVPYVFFSLPSIVFNFLRGEFGMWVAFVAVVLRLFFPRHFPD WLEMPGSLIILLVVTPGLIAGSVRDGLIGLFICLVIACYLLQEHIRASGGFRNSFTQSKGVSNSVGIILLMVYPVWGLVLNI | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 13,166.273 | ||
| Theoretical pI: | 11.339 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 50.359 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.882 | ||
Secondary Structure Fraction | |||
| Helix | 0.186 | ||
| turn | 0.297 | ||
| sheet | 0.161 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147486.1 | complete | 118 | 468-112(-) |
Amino Acid sequence : | |||
| MTRQMKRPIRPSLTDPAINPGVTTNKMINDPGISNQSGKCRGKKSRSTTATKATHIPNSPLKKLNTIEGRLKKTYGTKSEVNMFVFQFVRSNINKYIAAAQAKKARKDVPKPRPPSMR* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 13,166.273 | ||
| Theoretical pI: | 11.339 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 50.359 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.882 | ||
Secondary Structure Fraction | |||
| Helix | 0.186 | ||
| turn | 0.297 | ||
| sheet | 0.161 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147486.1 | internal | 202 | 2-607(+) |
Amino Acid sequence : | |||
| HEKMNYLAMKTDGVGSGLLESDLKNIGIAATQFANDTYLMLGGLGFGTSFLAFFACAAAIYLLILDRTNWKTNMLTSLLVPYVFFSLPSIVFNFLRGEFGMWVAFVAVVLRLFFPRHFPD WLEMPGSLIILLVVTPGLIAGSVRDGLIGLFICLVIACYLLQEHIRASGGFRNSFTQSKGVSNSVGIILLMVYPVWGLVLNI | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 13,166.273 | ||
| Theoretical pI: | 11.339 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 50.359 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.882 | ||
Secondary Structure Fraction | |||
| Helix | 0.186 | ||
| turn | 0.297 | ||
| sheet | 0.161 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147486.1 | complete | 118 | 468-112(-) |
Amino Acid sequence : | |||
| MTRQMKRPIRPSLTDPAINPGVTTNKMINDPGISNQSGKCRGKKSRSTTATKATHIPNSPLKKLNTIEGRLKKTYGTKSEVNMFVFQFVRSNINKYIAAAQAKKARKDVPKPRPPSMR* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 13,166.273 | ||
| Theoretical pI: | 11.339 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 50.359 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.882 | ||
Secondary Structure Fraction | |||
| Helix | 0.186 | ||
| turn | 0.297 | ||
| sheet | 0.161 | ||