Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147486.1 | internal | 202 | 2-607(+) |
Amino Acid sequence : | |||
HEKMNYLAMKTDGVGSGLLESDLKNIGIAATQFANDTYLMLGGLGFGTSFLAFFACAAAIYLLILDRTNWKTNMLTSLLVPYVFFSLPSIVFNFLRGEFGMWVAFVAVVLRLFFPRHFPD WLEMPGSLIILLVVTPGLIAGSVRDGLIGLFICLVIACYLLQEHIRASGGFRNSFTQSKGVSNSVGIILLMVYPVWGLVLNI | |||
Physicochemical properties | |||
Number of amino acids: | 202 | ||
Molecular weight: | 13,166.273 | ||
Theoretical pI: | 11.339 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 50.359 | ||
aromaticity | 0.042 | ||
GRAVY | -0.882 | ||
Secondary Structure Fraction | |||
Helix | 0.186 | ||
turn | 0.297 | ||
sheet | 0.161 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147486.1 | complete | 118 | 468-112(-) |
Amino Acid sequence : | |||
MTRQMKRPIRPSLTDPAINPGVTTNKMINDPGISNQSGKCRGKKSRSTTATKATHIPNSPLKKLNTIEGRLKKTYGTKSEVNMFVFQFVRSNINKYIAAAQAKKARKDVPKPRPPSMR* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 13,166.273 | ||
Theoretical pI: | 11.339 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 50.359 | ||
aromaticity | 0.042 | ||
GRAVY | -0.882 | ||
Secondary Structure Fraction | |||
Helix | 0.186 | ||
turn | 0.297 | ||
sheet | 0.161 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147486.1 | internal | 202 | 2-607(+) |
Amino Acid sequence : | |||
HEKMNYLAMKTDGVGSGLLESDLKNIGIAATQFANDTYLMLGGLGFGTSFLAFFACAAAIYLLILDRTNWKTNMLTSLLVPYVFFSLPSIVFNFLRGEFGMWVAFVAVVLRLFFPRHFPD WLEMPGSLIILLVVTPGLIAGSVRDGLIGLFICLVIACYLLQEHIRASGGFRNSFTQSKGVSNSVGIILLMVYPVWGLVLNI | |||
Physicochemical properties | |||
Number of amino acids: | 202 | ||
Molecular weight: | 13,166.273 | ||
Theoretical pI: | 11.339 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 50.359 | ||
aromaticity | 0.042 | ||
GRAVY | -0.882 | ||
Secondary Structure Fraction | |||
Helix | 0.186 | ||
turn | 0.297 | ||
sheet | 0.161 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147486.1 | complete | 118 | 468-112(-) |
Amino Acid sequence : | |||
MTRQMKRPIRPSLTDPAINPGVTTNKMINDPGISNQSGKCRGKKSRSTTATKATHIPNSPLKKLNTIEGRLKKTYGTKSEVNMFVFQFVRSNINKYIAAAQAKKARKDVPKPRPPSMR* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 13,166.273 | ||
Theoretical pI: | 11.339 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 50.359 | ||
aromaticity | 0.042 | ||
GRAVY | -0.882 | ||
Secondary Structure Fraction | |||
Helix | 0.186 | ||
turn | 0.297 | ||
sheet | 0.161 |