| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147507.1 | 5prime_partial | 139 | 2-421(+) |
Amino Acid sequence : | |||
| RALTYSTRMKKMGLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELSTQDKELAGISPGLVRMSVGYSGTIDQR WGQFEKAISRMQVDVHAKN* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 12,775.061 | ||
| Theoretical pI: | 9.676 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 57.716 | ||
| aromaticity | 0.018 | ||
| GRAVY | -1.291 | ||
Secondary Structure Fraction | |||
| Helix | 0.177 | ||
| turn | 0.292 | ||
| sheet | 0.168 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147507.1 | 5prime_partial | 113 | 1-342(+) |
Amino Acid sequence : | |||
| PGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRVEHSGQGACRHLPRTSQDVCRL* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,775.061 | ||
| Theoretical pI: | 9.676 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 57.716 | ||
| aromaticity | 0.018 | ||
| GRAVY | -1.291 | ||
Secondary Structure Fraction | |||
| Helix | 0.177 | ||
| turn | 0.292 | ||
| sheet | 0.168 | ||