| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147529.1 | 5prime_partial | 111 | 3-338(+) |
Amino Acid sequence : | |||
| EADLGFVNENARRYISQLPQHVRKSFPEKFPHVHPVAIDLVEKMLTFDPRQRITVEDALAHPYLASLHDISDEPVCSMPFSFDFEQHALSEEQMKELIYREALAFNPDYQQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,971.453 | ||
| Theoretical pI: | 4.958 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 49.282 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.483 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.180 | ||
| sheet | 0.297 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147529.1 | 5prime_partial | 111 | 3-338(+) |
Amino Acid sequence : | |||
| EADLGFVNENARRYISQLPQHVRKSFPEKFPHVHPVAIDLVEKMLTFDPRQRITVEDALAHPYLASLHDISDEPVCSMPFSFDFEQHALSEEQMKELIYREALAFNPDYQQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,971.453 | ||
| Theoretical pI: | 4.958 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 49.282 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.483 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.180 | ||
| sheet | 0.297 | ||