Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147529.1 | 5prime_partial | 111 | 3-338(+) |
Amino Acid sequence : | |||
EADLGFVNENARRYISQLPQHVRKSFPEKFPHVHPVAIDLVEKMLTFDPRQRITVEDALAHPYLASLHDISDEPVCSMPFSFDFEQHALSEEQMKELIYREALAFNPDYQQ* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,971.453 | ||
Theoretical pI: | 4.958 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 49.282 | ||
aromaticity | 0.108 | ||
GRAVY | -0.483 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.180 | ||
sheet | 0.297 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147529.1 | 5prime_partial | 111 | 3-338(+) |
Amino Acid sequence : | |||
EADLGFVNENARRYISQLPQHVRKSFPEKFPHVHPVAIDLVEKMLTFDPRQRITVEDALAHPYLASLHDISDEPVCSMPFSFDFEQHALSEEQMKELIYREALAFNPDYQQ* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,971.453 | ||
Theoretical pI: | 4.958 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 49.282 | ||
aromaticity | 0.108 | ||
GRAVY | -0.483 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.180 | ||
sheet | 0.297 |