| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147544.1 | internal | 130 | 2-391(+) |
Amino Acid sequence : | |||
| RSVVGSKGKVEEIDLDQLHYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMNIGTLVVE LPLANLLYSF | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,857.083 | ||
| Theoretical pI: | 6.469 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 37.219 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.167 | ||
Secondary Structure Fraction | |||
| Helix | 0.338 | ||
| turn | 0.231 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147544.1 | internal | 130 | 2-391(+) |
Amino Acid sequence : | |||
| RSVVGSKGKVEEIDLDQLHYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMNIGTLVVE LPLANLLYSF | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,857.083 | ||
| Theoretical pI: | 6.469 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 37.219 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.167 | ||
Secondary Structure Fraction | |||
| Helix | 0.338 | ||
| turn | 0.231 | ||
| sheet | 0.254 | ||