Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147551.1 | 5prime_partial | 144 | 1-435(+) |
Amino Acid sequence : | |||
AGALLVDGLGDGLLLEAYDKDFDFVRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAM EHATEALIQLIKDHGRWVDPSAEE* | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 15,563.579 | ||
Theoretical pI: | 4.920 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
Instability index: | 31.026 | ||
aromaticity | 0.069 | ||
GRAVY | -0.047 | ||
Secondary Structure Fraction | |||
Helix | 0.299 | ||
turn | 0.222 | ||
sheet | 0.285 |