| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147551.1 | 5prime_partial | 144 | 1-435(+) |
Amino Acid sequence : | |||
| AGALLVDGLGDGLLLEAYDKDFDFVRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAM EHATEALIQLIKDHGRWVDPSAEE* | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 15,563.579 | ||
| Theoretical pI: | 4.920 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 31.026 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.047 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.222 | ||
| sheet | 0.285 | ||