Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147553.1 | 5prime_partial | 139 | 3-422(+) |
Amino Acid sequence : | |||
TRNAKVAFELSERLPHLSLRMKEHRPPGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRVEH SGQGACRHLPRTSQDVCRL* | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 14,400.371 | ||
Theoretical pI: | 6.898 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 36.968 | ||
aromaticity | 0.069 | ||
GRAVY | -0.363 | ||
Secondary Structure Fraction | |||
Helix | 0.244 | ||
turn | 0.298 | ||
sheet | 0.282 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147553.1 | complete | 131 | 106-501(+) |
Amino Acid sequence : | |||
MKKMGLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELSTQDKELAGISPGLVRMSVGYSGTIDQRWGQFEKAI SRMQVDVHAKN* | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 14,400.371 | ||
Theoretical pI: | 6.898 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 36.968 | ||
aromaticity | 0.069 | ||
GRAVY | -0.363 | ||
Secondary Structure Fraction | |||
Helix | 0.244 | ||
turn | 0.298 | ||
sheet | 0.282 |