| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147562.1 | internal | 232 | 3-698(+) |
Amino Acid sequence : | |||
| ISLSEQQLAKAVASHGADIVRFTQKNILRVYPKGTRFNSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMHGFYRANGGCGYVKKPDFLQHTGPHGEVFDPKASLPAKKTLKVKVYMGDGW RMDFKQTHFDAYSPPDFYTRVGIAGVPADSIMKKTRAIEDDWTPVWNEEFDFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVSELRSGIRAIPLFDRKGMKFKSVKLLM | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 26,344.039 | ||
| Theoretical pI: | 9.084 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40910 41035 | ||
| Instability index: | 47.073 | ||
| aromaticity | 0.121 | ||
| GRAVY | -0.362 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.233 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147562.1 | internal | 232 | 3-698(+) |
Amino Acid sequence : | |||
| ISLSEQQLAKAVASHGADIVRFTQKNILRVYPKGTRFNSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMHGFYRANGGCGYVKKPDFLQHTGPHGEVFDPKASLPAKKTLKVKVYMGDGW RMDFKQTHFDAYSPPDFYTRVGIAGVPADSIMKKTRAIEDDWTPVWNEEFDFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVSELRSGIRAIPLFDRKGMKFKSVKLLM | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 26,344.039 | ||
| Theoretical pI: | 9.084 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40910 41035 | ||
| Instability index: | 47.073 | ||
| aromaticity | 0.121 | ||
| GRAVY | -0.362 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.233 | ||
| sheet | 0.228 | ||