Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147562.1 | internal | 232 | 3-698(+) |
Amino Acid sequence : | |||
ISLSEQQLAKAVASHGADIVRFTQKNILRVYPKGTRFNSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMHGFYRANGGCGYVKKPDFLQHTGPHGEVFDPKASLPAKKTLKVKVYMGDGW RMDFKQTHFDAYSPPDFYTRVGIAGVPADSIMKKTRAIEDDWTPVWNEEFDFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVSELRSGIRAIPLFDRKGMKFKSVKLLM | |||
Physicochemical properties | |||
Number of amino acids: | 232 | ||
Molecular weight: | 26,344.039 | ||
Theoretical pI: | 9.084 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40910 41035 | ||
Instability index: | 47.073 | ||
aromaticity | 0.121 | ||
GRAVY | -0.362 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.233 | ||
sheet | 0.228 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147562.1 | internal | 232 | 3-698(+) |
Amino Acid sequence : | |||
ISLSEQQLAKAVASHGADIVRFTQKNILRVYPKGTRFNSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMHGFYRANGGCGYVKKPDFLQHTGPHGEVFDPKASLPAKKTLKVKVYMGDGW RMDFKQTHFDAYSPPDFYTRVGIAGVPADSIMKKTRAIEDDWTPVWNEEFDFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVSELRSGIRAIPLFDRKGMKFKSVKLLM | |||
Physicochemical properties | |||
Number of amino acids: | 232 | ||
Molecular weight: | 26,344.039 | ||
Theoretical pI: | 9.084 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40910 41035 | ||
Instability index: | 47.073 | ||
aromaticity | 0.121 | ||
GRAVY | -0.362 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.233 | ||
sheet | 0.228 |