| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147566.1 | internal | 195 | 1-585(+) |
Amino Acid sequence : | |||
| YLMRVPAPGSLSALPSASLVKSVPMAEVLDASKERLFTGIVPDTSAKALSRYTEMVDDVIRTQAEKLQQANEITRVKLKEMDLPDSVLALEGSFSLPMDLKEDVEAVQISGGPSGLEAEI QQLRDLRRVNQELLVQTEELLQKEAGEDAQFRTQFGTRWTRPQSSTLTKNLQDRLNRFAANIKQATDSDARIERA | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 21,686.325 | ||
| Theoretical pI: | 5.009 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 47.416 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.437 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.195 | ||
| sheet | 0.333 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147566.1 | internal | 195 | 1-585(+) |
Amino Acid sequence : | |||
| YLMRVPAPGSLSALPSASLVKSVPMAEVLDASKERLFTGIVPDTSAKALSRYTEMVDDVIRTQAEKLQQANEITRVKLKEMDLPDSVLALEGSFSLPMDLKEDVEAVQISGGPSGLEAEI QQLRDLRRVNQELLVQTEELLQKEAGEDAQFRTQFGTRWTRPQSSTLTKNLQDRLNRFAANIKQATDSDARIERA | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 21,686.325 | ||
| Theoretical pI: | 5.009 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 47.416 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.437 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.195 | ||
| sheet | 0.333 | ||