Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147566.1 | internal | 195 | 1-585(+) |
Amino Acid sequence : | |||
YLMRVPAPGSLSALPSASLVKSVPMAEVLDASKERLFTGIVPDTSAKALSRYTEMVDDVIRTQAEKLQQANEITRVKLKEMDLPDSVLALEGSFSLPMDLKEDVEAVQISGGPSGLEAEI QQLRDLRRVNQELLVQTEELLQKEAGEDAQFRTQFGTRWTRPQSSTLTKNLQDRLNRFAANIKQATDSDARIERA | |||
Physicochemical properties | |||
Number of amino acids: | 195 | ||
Molecular weight: | 21,686.325 | ||
Theoretical pI: | 5.009 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 47.416 | ||
aromaticity | 0.041 | ||
GRAVY | -0.437 | ||
Secondary Structure Fraction | |||
Helix | 0.267 | ||
turn | 0.195 | ||
sheet | 0.333 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147566.1 | internal | 195 | 1-585(+) |
Amino Acid sequence : | |||
YLMRVPAPGSLSALPSASLVKSVPMAEVLDASKERLFTGIVPDTSAKALSRYTEMVDDVIRTQAEKLQQANEITRVKLKEMDLPDSVLALEGSFSLPMDLKEDVEAVQISGGPSGLEAEI QQLRDLRRVNQELLVQTEELLQKEAGEDAQFRTQFGTRWTRPQSSTLTKNLQDRLNRFAANIKQATDSDARIERA | |||
Physicochemical properties | |||
Number of amino acids: | 195 | ||
Molecular weight: | 21,686.325 | ||
Theoretical pI: | 5.009 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 47.416 | ||
aromaticity | 0.041 | ||
GRAVY | -0.437 | ||
Secondary Structure Fraction | |||
Helix | 0.267 | ||
turn | 0.195 | ||
sheet | 0.333 |