| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147577.1 | 5prime_partial | 124 | 1-375(+) |
Amino Acid sequence : | |||
| YNDCASYMLERLAKGTGSVVLATHNLDSGNAAAAKARELGIGKGNQKLQFSQLMGMADGLSLGLKNAGFIVSKYLPYGPVDQVIPYLLRRAEENRGLLSASVQDRELIRNELLRRMKTAL LGRV* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 13,508.498 | ||
| Theoretical pI: | 9.718 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
| Instability index: | 29.270 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.149 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.250 | ||
| sheet | 0.347 | ||