Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147577.1 | 5prime_partial | 124 | 1-375(+) |
Amino Acid sequence : | |||
YNDCASYMLERLAKGTGSVVLATHNLDSGNAAAAKARELGIGKGNQKLQFSQLMGMADGLSLGLKNAGFIVSKYLPYGPVDQVIPYLLRRAEENRGLLSASVQDRELIRNELLRRMKTAL LGRV* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 13,508.498 | ||
Theoretical pI: | 9.718 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
Instability index: | 29.270 | ||
aromaticity | 0.056 | ||
GRAVY | -0.149 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.250 | ||
sheet | 0.347 |