| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147587.1 | complete | 190 | 56-628(+) |
Amino Acid sequence : | |||
| MAKKLIQIDISSDTVCPWCFVGKKKLEKAMDMAKDQFDFEVRWHPFFLDASAPKEGIRKTEFYGKKFGATPFERMTSQMTEVFRGVGLEYDISGLTGNTLDSHRLINFAAHQGYDKQNAL VEELFLNYFCQGKYIGDRQVLLDAARKVGIEGAEEFLGNPSNGVLVVAMTTTLAAPKSILFAILRPALVK* | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 21,281.391 | ||
| Theoretical pI: | 7.684 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 29.337 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.107 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.189 | ||
| sheet | 0.279 | ||