Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147587.1 | complete | 190 | 56-628(+) |
Amino Acid sequence : | |||
MAKKLIQIDISSDTVCPWCFVGKKKLEKAMDMAKDQFDFEVRWHPFFLDASAPKEGIRKTEFYGKKFGATPFERMTSQMTEVFRGVGLEYDISGLTGNTLDSHRLINFAAHQGYDKQNAL VEELFLNYFCQGKYIGDRQVLLDAARKVGIEGAEEFLGNPSNGVLVVAMTTTLAAPKSILFAILRPALVK* | |||
Physicochemical properties | |||
Number of amino acids: | 190 | ||
Molecular weight: | 21,281.391 | ||
Theoretical pI: | 7.684 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
Instability index: | 29.337 | ||
aromaticity | 0.111 | ||
GRAVY | -0.107 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.189 | ||
sheet | 0.279 |