| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147603.1 | complete | 119 | 18-377(+) |
Amino Acid sequence : | |||
| MVQRLTYRKRHSYATKSNQTRVVKTPGGKLTYQTAKKRAKGPRCPVTGKRIQGIPHLRPTEYKRSRLARNRRTVNRAYGGVLSGSAVKERIIRAFLVEEQKIVKKVLKFQKAKDKVTKS* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,677.990 | ||
| Theoretical pI: | 11.601 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
| Instability index: | 35.810 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.903 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.185 | ||
| sheet | 0.168 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147603.1 | complete | 119 | 18-377(+) |
Amino Acid sequence : | |||
| MVQRLTYRKRHSYATKSNQTRVVKTPGGKLTYQTAKKRAKGPRCPVTGKRIQGIPHLRPTEYKRSRLARNRRTVNRAYGGVLSGSAVKERIIRAFLVEEQKIVKKVLKFQKAKDKVTKS* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,677.990 | ||
| Theoretical pI: | 11.601 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
| Instability index: | 35.810 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.903 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.185 | ||
| sheet | 0.168 | ||