| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147612.1 | 5prime_partial | 184 | 2-556(+) |
Amino Acid sequence : | |||
| AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM* | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 16,504.064 | ||
| Theoretical pI: | 5.756 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 40.430 | ||
| aromaticity | 0.027 | ||
| GRAVY | -0.013 | ||
Secondary Structure Fraction | |||
| Helix | 0.376 | ||
| turn | 0.262 | ||
| sheet | 0.329 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147612.1 | complete | 149 | 526-77(-) |
Amino Acid sequence : | |||
| MKSRLLLNVVVSEGTTVLKLLPSKDEPLLVRWDPLLVLNFRLNIVDSVGALHLQGNGLPSQSLDKNLHPTPEPEHQMKGRLLLDVVIGEGTAVLKLFPRKDEPLLIRRDPLLVLDLGLHV VDSIGALHLEGYGLPRESLHEDLHPSPEP* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 16,504.064 | ||
| Theoretical pI: | 5.756 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 40.430 | ||
| aromaticity | 0.027 | ||
| GRAVY | -0.013 | ||
Secondary Structure Fraction | |||
| Helix | 0.376 | ||
| turn | 0.262 | ||
| sheet | 0.329 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147612.1 | 5prime_partial | 184 | 2-556(+) |
Amino Acid sequence : | |||
| AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM* | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 16,504.064 | ||
| Theoretical pI: | 5.756 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 40.430 | ||
| aromaticity | 0.027 | ||
| GRAVY | -0.013 | ||
Secondary Structure Fraction | |||
| Helix | 0.376 | ||
| turn | 0.262 | ||
| sheet | 0.329 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147612.1 | complete | 149 | 526-77(-) |
Amino Acid sequence : | |||
| MKSRLLLNVVVSEGTTVLKLLPSKDEPLLVRWDPLLVLNFRLNIVDSVGALHLQGNGLPSQSLDKNLHPTPEPEHQMKGRLLLDVVIGEGTAVLKLFPRKDEPLLIRRDPLLVLDLGLHV VDSIGALHLEGYGLPRESLHEDLHPSPEP* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 16,504.064 | ||
| Theoretical pI: | 5.756 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 40.430 | ||
| aromaticity | 0.027 | ||
| GRAVY | -0.013 | ||
Secondary Structure Fraction | |||
| Helix | 0.376 | ||
| turn | 0.262 | ||
| sheet | 0.329 | ||