Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147619.1 | complete | 220 | 26-688(+) |
Amino Acid sequence : | |||
MAKVNGSDEPAGRTIEIDQKTLYGVLRGFVEGISADAGGGEPLARRIRSSFFRTAPHLREASRNSVHDLLRWTRQGSPLRALLVISVGTITLISLTGLLVFMIFFVAATLNAIIISALLS LAAAGGFLALFFACLTGIYIAALSTAVFVISAITISTIIAVMVATGWIGFFCIIWLAAKKSMDLTKQSLSITSSAVSLYTASRKTQQDDAYLKSPPVEAN* | |||
Physicochemical properties | |||
Number of amino acids: | 220 | ||
Molecular weight: | 23,460.195 | ||
Theoretical pI: | 9.637 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
Instability index: | 41.711 | ||
aromaticity | 0.086 | ||
GRAVY | 0.622 | ||
Secondary Structure Fraction | |||
Helix | 0.368 | ||
turn | 0.218 | ||
sheet | 0.295 |