| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147624.1 | internal | 191 | 3-575(+) |
Amino Acid sequence : | |||
| APFVVNIYPFLSLYQNPDFPVDFAFFDGVGRPVKDENVRYSNMFDANYDTLVSALKKAGVDDMKIIVGEAGWPTDGNKNANLDYAEKFYSGLLKKLGNDKGTPLRPGSIEVYLFGLIDEN MKSVMPGTFERHWGIFTYDGKPKFPMDLSGQGGHNKYLVGAKGIEYMPTQWCVLDKDAESDTAQVKSQLNY | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 21,506.528 | ||
| Theoretical pI: | 5.498 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 56.879 | ||
| aromaticity | 0.047 | ||
| GRAVY | 0.108 | ||
Secondary Structure Fraction | |||
| Helix | 0.398 | ||
| turn | 0.188 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147624.1 | internal | 191 | 575-3(-) |
Amino Acid sequence : | |||
| VVELALHLCCVGLGILIQHAPLRWHVLYPLGSDQVLVVPPLSRQVHRKLWLPVVSENTPVTFESSRHDALHVLVDQSEEVHFDASRSQWCAFVISQLLQEPGVKLLGIIKIGILVSVRRP SRFPDYDLHVVDAGLLQGGDERVVVRIEHVAIPNVLILHRPTDPIEEGEVDREVRVLVEAEERVDVDHEGR | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 21,506.528 | ||
| Theoretical pI: | 5.498 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 56.879 | ||
| aromaticity | 0.047 | ||
| GRAVY | 0.108 | ||
Secondary Structure Fraction | |||
| Helix | 0.398 | ||
| turn | 0.188 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147624.1 | internal | 191 | 3-575(+) |
Amino Acid sequence : | |||
| APFVVNIYPFLSLYQNPDFPVDFAFFDGVGRPVKDENVRYSNMFDANYDTLVSALKKAGVDDMKIIVGEAGWPTDGNKNANLDYAEKFYSGLLKKLGNDKGTPLRPGSIEVYLFGLIDEN MKSVMPGTFERHWGIFTYDGKPKFPMDLSGQGGHNKYLVGAKGIEYMPTQWCVLDKDAESDTAQVKSQLNY | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 21,506.528 | ||
| Theoretical pI: | 5.498 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 56.879 | ||
| aromaticity | 0.047 | ||
| GRAVY | 0.108 | ||
Secondary Structure Fraction | |||
| Helix | 0.398 | ||
| turn | 0.188 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147624.1 | internal | 191 | 575-3(-) |
Amino Acid sequence : | |||
| VVELALHLCCVGLGILIQHAPLRWHVLYPLGSDQVLVVPPLSRQVHRKLWLPVVSENTPVTFESSRHDALHVLVDQSEEVHFDASRSQWCAFVISQLLQEPGVKLLGIIKIGILVSVRRP SRFPDYDLHVVDAGLLQGGDERVVVRIEHVAIPNVLILHRPTDPIEEGEVDREVRVLVEAEERVDVDHEGR | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 21,506.528 | ||
| Theoretical pI: | 5.498 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 56.879 | ||
| aromaticity | 0.047 | ||
| GRAVY | 0.108 | ||
Secondary Structure Fraction | |||
| Helix | 0.398 | ||
| turn | 0.188 | ||
| sheet | 0.257 | ||