Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147625.1 | 5prime_partial | 101 | 2-307(+) |
Amino Acid sequence : | |||
SSAMAEASEKKSVHIVYMDRPEAEEPEAFHIKTLASAVGSEAAAKEAVIYHYTHAASGFSAKLTSKEAEELSKQPGVLQVTPDSTVQLHNKPARVGHMGLT* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 10,788.994 | ||
Theoretical pI: | 6.035 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 55.540 | ||
aromaticity | 0.050 | ||
GRAVY | -0.354 | ||
Secondary Structure Fraction | |||
Helix | 0.218 | ||
turn | 0.218 | ||
sheet | 0.356 |