| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147625.1 | 5prime_partial | 101 | 2-307(+) |
Amino Acid sequence : | |||
| SSAMAEASEKKSVHIVYMDRPEAEEPEAFHIKTLASAVGSEAAAKEAVIYHYTHAASGFSAKLTSKEAEELSKQPGVLQVTPDSTVQLHNKPARVGHMGLT* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 10,788.994 | ||
| Theoretical pI: | 6.035 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 55.540 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.354 | ||
Secondary Structure Fraction | |||
| Helix | 0.218 | ||
| turn | 0.218 | ||
| sheet | 0.356 | ||