| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147636.1 | 5prime_partial | 155 | 2-469(+) |
Amino Acid sequence : | |||
| IDLDQLHYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMNIGTLVVELPLANLLYSFNW ELPAGIFKDDINMDESPGIAIHRKYALHLVAKRYK* | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 17,893.591 | ||
| Theoretical pI: | 6.649 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 36.608 | ||
| aromaticity | 0.103 | ||
| GRAVY | -0.199 | ||
Secondary Structure Fraction | |||
| Helix | 0.342 | ||
| turn | 0.213 | ||
| sheet | 0.265 | ||