Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147636.1 | 5prime_partial | 155 | 2-469(+) |
Amino Acid sequence : | |||
IDLDQLHYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMNIGTLVVELPLANLLYSFNW ELPAGIFKDDINMDESPGIAIHRKYALHLVAKRYK* | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 17,893.591 | ||
Theoretical pI: | 6.649 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
Instability index: | 36.608 | ||
aromaticity | 0.103 | ||
GRAVY | -0.199 | ||
Secondary Structure Fraction | |||
Helix | 0.342 | ||
turn | 0.213 | ||
sheet | 0.265 |