| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147644.1 | internal | 220 | 2-661(+) |
Amino Acid sequence : | |||
| KGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVEILKLMTATFLVGICQAVDLRHLEENLRHAVKNTVSQVAKKVLTTGANGELHPSRFCEKDLIKVVDHECV FGYIDDPCSAAYPLMQKLRQVLVEHALVTITVTGEKGLGVSVFEKIVVFEKELRAVLPREVEAARTAVEDGNAVISNRIKECRSYPLYRFVREELGTGFL | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 22,465.212 | ||
| Theoretical pI: | 6.280 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
| Instability index: | 57.377 | ||
| aromaticity | 0.034 | ||
| GRAVY | -1.083 | ||
Secondary Structure Fraction | |||
| Helix | 0.168 | ||
| turn | 0.313 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147644.1 | 5prime_partial | 208 | 1-627(+) |
Amino Acid sequence : | |||
| QRCGDSDGVLLLRAPVSREPGDQPRAERGAAQSGCELSGIDLFEKDRGGGRDLEAHDGDLLGRDMPGCRFAPPGGESETRGQEHGEPGGEEGPDDGSERGATPVPILREGSHQSGRSRVR VRVHRRSLQRRLSSDAEAETGSCRTRARYHYRYRREGIRGVRIRKDCGFREGVEGGSAERSGGGEDGGGGWQCRDIEQDKGVQVVSSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 22,465.212 | ||
| Theoretical pI: | 6.280 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
| Instability index: | 57.377 | ||
| aromaticity | 0.034 | ||
| GRAVY | -1.083 | ||
Secondary Structure Fraction | |||
| Helix | 0.168 | ||
| turn | 0.313 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147644.1 | internal | 220 | 2-661(+) |
Amino Acid sequence : | |||
| KGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVEILKLMTATFLVGICQAVDLRHLEENLRHAVKNTVSQVAKKVLTTGANGELHPSRFCEKDLIKVVDHECV FGYIDDPCSAAYPLMQKLRQVLVEHALVTITVTGEKGLGVSVFEKIVVFEKELRAVLPREVEAARTAVEDGNAVISNRIKECRSYPLYRFVREELGTGFL | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 22,465.212 | ||
| Theoretical pI: | 6.280 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
| Instability index: | 57.377 | ||
| aromaticity | 0.034 | ||
| GRAVY | -1.083 | ||
Secondary Structure Fraction | |||
| Helix | 0.168 | ||
| turn | 0.313 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147644.1 | 5prime_partial | 208 | 1-627(+) |
Amino Acid sequence : | |||
| QRCGDSDGVLLLRAPVSREPGDQPRAERGAAQSGCELSGIDLFEKDRGGGRDLEAHDGDLLGRDMPGCRFAPPGGESETRGQEHGEPGGEEGPDDGSERGATPVPILREGSHQSGRSRVR VRVHRRSLQRRLSSDAEAETGSCRTRARYHYRYRREGIRGVRIRKDCGFREGVEGGSAERSGGGEDGGGGWQCRDIEQDKGVQVVSSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 22,465.212 | ||
| Theoretical pI: | 6.280 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
| Instability index: | 57.377 | ||
| aromaticity | 0.034 | ||
| GRAVY | -1.083 | ||
Secondary Structure Fraction | |||
| Helix | 0.168 | ||
| turn | 0.313 | ||
| sheet | 0.212 | ||