| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147677.1 | internal | 188 | 2-565(+) |
Amino Acid sequence : | |||
| HEPWSEYRYYDPRTVGLDFDGMIADIKAAPDGSFILLHGCAHNPTGIDPTPDQWEKIADVIQEKNHVPFFDVAYQGFASGSLDEDASSVRLFVARGMELLVAQSYSKNLGLYAERIGAIN VVCSSPEAATRVKSQLKRLARPMYSNPPIHGAKIVANVVGDPTLFNEWKEEMELMAGRIKNVRQRLFD | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 20,996.576 | ||
| Theoretical pI: | 5.551 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
| Instability index: | 29.286 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.296 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.239 | ||
| sheet | 0.261 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147677.1 | internal | 188 | 2-565(+) |
Amino Acid sequence : | |||
| HEPWSEYRYYDPRTVGLDFDGMIADIKAAPDGSFILLHGCAHNPTGIDPTPDQWEKIADVIQEKNHVPFFDVAYQGFASGSLDEDASSVRLFVARGMELLVAQSYSKNLGLYAERIGAIN VVCSSPEAATRVKSQLKRLARPMYSNPPIHGAKIVANVVGDPTLFNEWKEEMELMAGRIKNVRQRLFD | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 20,996.576 | ||
| Theoretical pI: | 5.551 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
| Instability index: | 29.286 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.296 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.239 | ||
| sheet | 0.261 | ||