Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147710.1 | 5prime_partial | 167 | 3-506(+) |
Amino Acid sequence : | |||
TRLWQVPETLHEDILGKMSAPPKSEVPIITPNELAEADGLIFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGIFFSTGSQGGGQETTALTAITQLTHHGMIFVPIGYTFGAGMFE MEEVKGGSPYGSGTFAGDGSRTPTDLELKQAFHQGQYFANIAKKFKS* | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 17,908.156 | ||
Theoretical pI: | 6.047 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 36.716 | ||
aromaticity | 0.114 | ||
GRAVY | -0.144 | ||
Secondary Structure Fraction | |||
Helix | 0.263 | ||
turn | 0.257 | ||
sheet | 0.269 |