| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147720.1 | internal | 142 | 2-427(+) |
Amino Acid sequence : | |||
| HETKIWRMRNNGTAAWPFGTQLVWVGGDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGV AIIDVNVAPPDSGFTESDITCT | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,571.138 | ||
| Theoretical pI: | 4.860 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 31970 | ||
| Instability index: | 29.761 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.403 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.324 | ||
| sheet | 0.176 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147720.1 | internal | 142 | 2-427(+) |
Amino Acid sequence : | |||
| HETKIWRMRNNGTAAWPFGTQLVWVGGDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGV AIIDVNVAPPDSGFTESDITCT | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,571.138 | ||
| Theoretical pI: | 4.860 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 31970 | ||
| Instability index: | 29.761 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.403 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.324 | ||
| sheet | 0.176 | ||