Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147724.1 | internal | 113 | 2-340(+) |
Amino Acid sequence : | |||
LLEEGDLVICPEGTTCREPFLLRFSALFAELTDRIVPVAVNTKQSMFYGTSTRGWKLLDPYFVFMNPRPTYEITFLNQLPKELTCAGGKSPIEVANYIQRVLGGTLGFECTNF | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,718.574 | ||
Theoretical pI: | 5.077 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
Instability index: | 45.112 | ||
aromaticity | 0.124 | ||
GRAVY | 0.063 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.230 | ||
sheet | 0.265 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147724.1 | internal | 113 | 2-340(+) |
Amino Acid sequence : | |||
LLEEGDLVICPEGTTCREPFLLRFSALFAELTDRIVPVAVNTKQSMFYGTSTRGWKLLDPYFVFMNPRPTYEITFLNQLPKELTCAGGKSPIEVANYIQRVLGGTLGFECTNF | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,718.574 | ||
Theoretical pI: | 5.077 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
Instability index: | 45.112 | ||
aromaticity | 0.124 | ||
GRAVY | 0.063 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.230 | ||
sheet | 0.265 |