| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147729.1 | internal | 105 | 3-317(+) |
Amino Acid sequence : | |||
| PVYQTEKFTKVDDERRVKVAVVTQGGMLDLGFLSFLNIFEIIERTDDSCTIRSSLEYEVDDEHADAAKLASTASLAMIAKAIVKHLLENEKEGCMKVMSSKLCFD | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,475.028 | ||
| Theoretical pI: | 9.887 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 72.325 | ||
| aromaticity | 0.118 | ||
| GRAVY | -0.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.284 | ||
| turn | 0.284 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147729.1 | 5prime_partial | 102 | 316-8(-) |
Amino Acid sequence : | |||
| SKQSLELITFMHPSFSFSRRCFTMAFAIMAREAVLANLAASACSSSTSYSKDDLIVQESSVRSMISKMFRNERNPKSNIPPWVTTATFTLRSSSTFVNFSVW* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,475.028 | ||
| Theoretical pI: | 9.887 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 72.325 | ||
| aromaticity | 0.118 | ||
| GRAVY | -0.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.284 | ||
| turn | 0.284 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147729.1 | internal | 105 | 3-317(+) |
Amino Acid sequence : | |||
| PVYQTEKFTKVDDERRVKVAVVTQGGMLDLGFLSFLNIFEIIERTDDSCTIRSSLEYEVDDEHADAAKLASTASLAMIAKAIVKHLLENEKEGCMKVMSSKLCFD | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,475.028 | ||
| Theoretical pI: | 9.887 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 72.325 | ||
| aromaticity | 0.118 | ||
| GRAVY | -0.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.284 | ||
| turn | 0.284 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147729.1 | 5prime_partial | 102 | 316-8(-) |
Amino Acid sequence : | |||
| SKQSLELITFMHPSFSFSRRCFTMAFAIMAREAVLANLAASACSSSTSYSKDDLIVQESSVRSMISKMFRNERNPKSNIPPWVTTATFTLRSSSTFVNFSVW* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,475.028 | ||
| Theoretical pI: | 9.887 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 72.325 | ||
| aromaticity | 0.118 | ||
| GRAVY | -0.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.284 | ||
| turn | 0.284 | ||
| sheet | 0.235 | ||