Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147735.1 | internal | 159 | 1-477(+) |
Amino Acid sequence : | |||
AKSDLEHILGVNLIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRA EDVANAVLYLASDESAYVSGQNLVVDGGYSVGNPSINAF | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 12,572.970 | ||
Theoretical pI: | 11.443 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 52.815 | ||
aromaticity | 0.054 | ||
GRAVY | -1.104 | ||
Secondary Structure Fraction | |||
Helix | 0.179 | ||
turn | 0.330 | ||
sheet | 0.143 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147735.1 | 5prime_partial | 112 | 3-341(+) |
Amino Acid sequence : | |||
KVRPGTHPRRQFNRPVPRHEARCSCHDPCSLPRLHHFHVQYCVGERRHNPSRVRLFEARGGGANQVRGIRARNTRNPCELRLPSAPFHSSDHGLLQQDRGGGGGGDGFRGKS* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,572.970 | ||
Theoretical pI: | 11.443 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 52.815 | ||
aromaticity | 0.054 | ||
GRAVY | -1.104 | ||
Secondary Structure Fraction | |||
Helix | 0.179 | ||
turn | 0.330 | ||
sheet | 0.143 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147735.1 | internal | 159 | 1-477(+) |
Amino Acid sequence : | |||
AKSDLEHILGVNLIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRA EDVANAVLYLASDESAYVSGQNLVVDGGYSVGNPSINAF | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 12,572.970 | ||
Theoretical pI: | 11.443 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 52.815 | ||
aromaticity | 0.054 | ||
GRAVY | -1.104 | ||
Secondary Structure Fraction | |||
Helix | 0.179 | ||
turn | 0.330 | ||
sheet | 0.143 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147735.1 | 5prime_partial | 112 | 3-341(+) |
Amino Acid sequence : | |||
KVRPGTHPRRQFNRPVPRHEARCSCHDPCSLPRLHHFHVQYCVGERRHNPSRVRLFEARGGGANQVRGIRARNTRNPCELRLPSAPFHSSDHGLLQQDRGGGGGGDGFRGKS* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,572.970 | ||
Theoretical pI: | 11.443 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 52.815 | ||
aromaticity | 0.054 | ||
GRAVY | -1.104 | ||
Secondary Structure Fraction | |||
Helix | 0.179 | ||
turn | 0.330 | ||
sheet | 0.143 |