| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147745.1 | internal | 196 | 3-590(+) |
Amino Acid sequence : | |||
| WRMRNNGTAAWPFGTQLVWVGGDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGVAIIDV NVAPPDSGFTESDITCTAEELVKSVEEHPSQVVVGDLLDASNDALPHPQPTLADVVPPTTLYPLIDIPSPEVPAAD | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 21,152.289 | ||
| Theoretical pI: | 4.327 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
| Instability index: | 39.005 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.269 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.316 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147745.1 | internal | 196 | 3-590(+) |
Amino Acid sequence : | |||
| WRMRNNGTAAWPFGTQLVWVGGDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGVAIIDV NVAPPDSGFTESDITCTAEELVKSVEEHPSQVVVGDLLDASNDALPHPQPTLADVVPPTTLYPLIDIPSPEVPAAD | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 21,152.289 | ||
| Theoretical pI: | 4.327 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
| Instability index: | 39.005 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.269 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.316 | ||
| sheet | 0.214 | ||