| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147752.1 | internal | 167 | 3-503(+) |
Amino Acid sequence : | |||
| PGCRNSAPENEKSPAELALIVEHLMAELEVTAEEDAELNRQSKPAINKLKKLPLLIDVLSKKKLQQEFLDHGVLTLLKNWLEPLPDGSLPNMNIRTAILKILSDFPINLEQYDRKEQLKK SGLGKVIMFLSKSDEETTSNRKLAKELVDKWSRPIFNKSTRFEDMRG | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 19,048.853 | ||
| Theoretical pI: | 8.293 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 40.186 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.542 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.228 | ||
| sheet | 0.335 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147752.1 | internal | 167 | 3-503(+) |
Amino Acid sequence : | |||
| PGCRNSAPENEKSPAELALIVEHLMAELEVTAEEDAELNRQSKPAINKLKKLPLLIDVLSKKKLQQEFLDHGVLTLLKNWLEPLPDGSLPNMNIRTAILKILSDFPINLEQYDRKEQLKK SGLGKVIMFLSKSDEETTSNRKLAKELVDKWSRPIFNKSTRFEDMRG | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 19,048.853 | ||
| Theoretical pI: | 8.293 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 40.186 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.542 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.228 | ||
| sheet | 0.335 | ||