| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147766.1 | internal | 208 | 2-625(+) |
Amino Acid sequence : | |||
| RSSGLVALLALQVASEYHRLGWKPPVTTGLLLTNTLIYLRPGPLDRILPHLDQVAFNPNYILKYGDLKRFFLSAFYHMGESHLFYNMTSLLWKGIQLETSMGSVDFASMVASLLCLSQGM TLILAKSLLLFFDYETAYYRQFGVGFSGVLFAMKVVLNSQSDGYSDVYGAQIPSRHAAWAELILIQLFVPGVSFLGHLGGIIAGLVYL | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 23,079.728 | ||
| Theoretical pI: | 8.025 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34380 | ||
| Instability index: | 30.790 | ||
| aromaticity | 0.135 | ||
| GRAVY | 0.488 | ||
Secondary Structure Fraction | |||
| Helix | 0.428 | ||
| turn | 0.240 | ||
| sheet | 0.303 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147766.1 | internal | 208 | 2-625(+) |
Amino Acid sequence : | |||
| RSSGLVALLALQVASEYHRLGWKPPVTTGLLLTNTLIYLRPGPLDRILPHLDQVAFNPNYILKYGDLKRFFLSAFYHMGESHLFYNMTSLLWKGIQLETSMGSVDFASMVASLLCLSQGM TLILAKSLLLFFDYETAYYRQFGVGFSGVLFAMKVVLNSQSDGYSDVYGAQIPSRHAAWAELILIQLFVPGVSFLGHLGGIIAGLVYL | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 23,079.728 | ||
| Theoretical pI: | 8.025 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34380 | ||
| Instability index: | 30.790 | ||
| aromaticity | 0.135 | ||
| GRAVY | 0.488 | ||
Secondary Structure Fraction | |||
| Helix | 0.428 | ||
| turn | 0.240 | ||
| sheet | 0.303 | ||