Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147766.1 | internal | 208 | 2-625(+) |
Amino Acid sequence : | |||
RSSGLVALLALQVASEYHRLGWKPPVTTGLLLTNTLIYLRPGPLDRILPHLDQVAFNPNYILKYGDLKRFFLSAFYHMGESHLFYNMTSLLWKGIQLETSMGSVDFASMVASLLCLSQGM TLILAKSLLLFFDYETAYYRQFGVGFSGVLFAMKVVLNSQSDGYSDVYGAQIPSRHAAWAELILIQLFVPGVSFLGHLGGIIAGLVYL | |||
Physicochemical properties | |||
Number of amino acids: | 208 | ||
Molecular weight: | 23,079.728 | ||
Theoretical pI: | 8.025 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34380 | ||
Instability index: | 30.790 | ||
aromaticity | 0.135 | ||
GRAVY | 0.488 | ||
Secondary Structure Fraction | |||
Helix | 0.428 | ||
turn | 0.240 | ||
sheet | 0.303 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147766.1 | internal | 208 | 2-625(+) |
Amino Acid sequence : | |||
RSSGLVALLALQVASEYHRLGWKPPVTTGLLLTNTLIYLRPGPLDRILPHLDQVAFNPNYILKYGDLKRFFLSAFYHMGESHLFYNMTSLLWKGIQLETSMGSVDFASMVASLLCLSQGM TLILAKSLLLFFDYETAYYRQFGVGFSGVLFAMKVVLNSQSDGYSDVYGAQIPSRHAAWAELILIQLFVPGVSFLGHLGGIIAGLVYL | |||
Physicochemical properties | |||
Number of amino acids: | 208 | ||
Molecular weight: | 23,079.728 | ||
Theoretical pI: | 8.025 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34380 | ||
Instability index: | 30.790 | ||
aromaticity | 0.135 | ||
GRAVY | 0.488 | ||
Secondary Structure Fraction | |||
Helix | 0.428 | ||
turn | 0.240 | ||
sheet | 0.303 |