| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147772.1 | 3prime_partial | 152 | 32-487(+) |
Amino Acid sequence : | |||
| MGKGTEAFPDLGEHCEKENCNQLDFLPFTCAGCQKVFCLEHRTYKAHDCPKSEHRSRTVVICEICSLSIEKKGAEEEKAVLERHAKSADCDPTKKMTKPKCPVKRCKELLTFSNTNTCKA CNTNVCLKHRFPSDHSCTNLLLLPTMRKGANC | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 17,080.671 | ||
| Theoretical pI: | 8.573 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 2490 | ||
| Instability index: | 37.323 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.593 | ||
Secondary Structure Fraction | |||
| Helix | 0.191 | ||
| turn | 0.197 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147772.1 | 3prime_partial | 152 | 32-487(+) |
Amino Acid sequence : | |||
| MGKGTEAFPDLGEHCEKENCNQLDFLPFTCAGCQKVFCLEHRTYKAHDCPKSEHRSRTVVICEICSLSIEKKGAEEEKAVLERHAKSADCDPTKKMTKPKCPVKRCKELLTFSNTNTCKA CNTNVCLKHRFPSDHSCTNLLLLPTMRKGANC | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 17,080.671 | ||
| Theoretical pI: | 8.573 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 2490 | ||
| Instability index: | 37.323 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.593 | ||
Secondary Structure Fraction | |||
| Helix | 0.191 | ||
| turn | 0.197 | ||
| sheet | 0.250 | ||