| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147777.1 | 5prime_partial | 123 | 3-374(+) |
Amino Acid sequence : | |||
| NDCASYMLERLAKGTGSVVLATHNLDSGNAAAAKARELGIGKGNQKLQFSQLMGMADGLSLGLKNAGFIVSKYLPYGPVDQVIPYLLRRAEENRGLLSASVQDRELIRNELLRRMKTALL GRV* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 13,345.325 | ||
| Theoretical pI: | 9.772 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 29.427 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.252 | ||
| sheet | 0.350 | ||