| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147792.1 | internal | 209 | 3-629(+) |
Amino Acid sequence : | |||
| KVVPRLQKITKKMNLPMVKGNVILNMDHLIEYKPNQTDLFNTRATKSQFESWFEAVRNEYELDDTQMGVIMNGFMVWCIDNGTSPDINGVWIMMDGDEQIEYPLKPMVENAKPTLRQIMH HFSDAAEAYIEMRNSEGLYMPRYGLLRNLRDRSLARYAFDFYEVNSKTSDRAREAVAQMKAAALTNVNSRLFGLDGNASTNLENTERHT | |||
Physicochemical properties | |||
| Number of amino acids: | 209 | ||
| Molecular weight: | 24,139.212 | ||
| Theoretical pI: | 5.864 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
| Instability index: | 32.712 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.545 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.220 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147792.1 | internal | 209 | 3-629(+) |
Amino Acid sequence : | |||
| KVVPRLQKITKKMNLPMVKGNVILNMDHLIEYKPNQTDLFNTRATKSQFESWFEAVRNEYELDDTQMGVIMNGFMVWCIDNGTSPDINGVWIMMDGDEQIEYPLKPMVENAKPTLRQIMH HFSDAAEAYIEMRNSEGLYMPRYGLLRNLRDRSLARYAFDFYEVNSKTSDRAREAVAQMKAAALTNVNSRLFGLDGNASTNLENTERHT | |||
Physicochemical properties | |||
| Number of amino acids: | 209 | ||
| Molecular weight: | 24,139.212 | ||
| Theoretical pI: | 5.864 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
| Instability index: | 32.712 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.545 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.220 | ||
| sheet | 0.287 | ||