Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147792.1 | internal | 209 | 3-629(+) |
Amino Acid sequence : | |||
KVVPRLQKITKKMNLPMVKGNVILNMDHLIEYKPNQTDLFNTRATKSQFESWFEAVRNEYELDDTQMGVIMNGFMVWCIDNGTSPDINGVWIMMDGDEQIEYPLKPMVENAKPTLRQIMH HFSDAAEAYIEMRNSEGLYMPRYGLLRNLRDRSLARYAFDFYEVNSKTSDRAREAVAQMKAAALTNVNSRLFGLDGNASTNLENTERHT | |||
Physicochemical properties | |||
Number of amino acids: | 209 | ||
Molecular weight: | 24,139.212 | ||
Theoretical pI: | 5.864 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
Instability index: | 32.712 | ||
aromaticity | 0.091 | ||
GRAVY | -0.545 | ||
Secondary Structure Fraction | |||
Helix | 0.278 | ||
turn | 0.220 | ||
sheet | 0.287 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147792.1 | internal | 209 | 3-629(+) |
Amino Acid sequence : | |||
KVVPRLQKITKKMNLPMVKGNVILNMDHLIEYKPNQTDLFNTRATKSQFESWFEAVRNEYELDDTQMGVIMNGFMVWCIDNGTSPDINGVWIMMDGDEQIEYPLKPMVENAKPTLRQIMH HFSDAAEAYIEMRNSEGLYMPRYGLLRNLRDRSLARYAFDFYEVNSKTSDRAREAVAQMKAAALTNVNSRLFGLDGNASTNLENTERHT | |||
Physicochemical properties | |||
Number of amino acids: | 209 | ||
Molecular weight: | 24,139.212 | ||
Theoretical pI: | 5.864 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
Instability index: | 32.712 | ||
aromaticity | 0.091 | ||
GRAVY | -0.545 | ||
Secondary Structure Fraction | |||
Helix | 0.278 | ||
turn | 0.220 | ||
sheet | 0.287 |