Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147799.1 | 5prime_partial | 149 | 1-450(+) |
Amino Acid sequence : | |||
HYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMNIGILVVELPLANLLYSFNWELPAGI FKDDINMDESPGIAIHRKYALHLVAKRYK* | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 17,207.868 | ||
Theoretical pI: | 7.915 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
Instability index: | 38.973 | ||
aromaticity | 0.107 | ||
GRAVY | -0.183 | ||
Secondary Structure Fraction | |||
Helix | 0.342 | ||
turn | 0.221 | ||
sheet | 0.262 |