Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147805.1 | 5prime_partial | 169 | 1-510(+) |
Amino Acid sequence : | |||
TSVIKMYPQGRMSHHFREMKVGDYLSVKGPKGRFKYQPGQVRAFGMLAGGSGITPMFQVARAILENPSDRTKVYLIYANVTHEDILLKEELDGLASNYPERFRIYYVLNQPPEVWNGGVG FVSKEMIQTHCPAPASDVQVLRCGPPPMNKAMAAHLDDLGYTKEMQFQF* | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 19,057.794 | ||
Theoretical pI: | 8.830 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19035 | ||
Instability index: | 30.693 | ||
aromaticity | 0.107 | ||
GRAVY | -0.343 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.249 | ||
sheet | 0.243 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147805.1 | 5prime_partial | 169 | 1-510(+) |
Amino Acid sequence : | |||
TSVIKMYPQGRMSHHFREMKVGDYLSVKGPKGRFKYQPGQVRAFGMLAGGSGITPMFQVARAILENPSDRTKVYLIYANVTHEDILLKEELDGLASNYPERFRIYYVLNQPPEVWNGGVG FVSKEMIQTHCPAPASDVQVLRCGPPPMNKAMAAHLDDLGYTKEMQFQF* | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 19,057.794 | ||
Theoretical pI: | 8.830 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19035 | ||
Instability index: | 30.693 | ||
aromaticity | 0.107 | ||
GRAVY | -0.343 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.249 | ||
sheet | 0.243 |